GenomeNet

>kvl:KVU_0423 glutathione S-transferase family protein (EC:2.5.1.18); K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MSEPVLYGHPDSGHACKVALALELAGVPHQRIWVDIWAAPETRPAAFLAGSPFAEVPLLV
IDQQPYVQSGAILLEIAQRYQVLGGDSHAGLRRARELIVWEANRIGMCLPQIHYAAKVQN
QGFPPGALDWLRARYQVDRANFDRLLGDAAFFHGDAPGVGDCAIWGYTQWINRMGVEPTT
SMLRWIDNMRALPGMKTPESFFPN

BLAST