GenomeNet

>lbc:LACBIDRAFT_248389 K01113 alkaline phosphatase D [EC:3.1.3.1] | (RefSeq) hypothetical protein (A)
LTFTHSVASGDPFDSSVILWTRAVPKSLDGTTLLPDQSVPACVSYRVYTFPTLSGKPVSS
GEAFTSYDVDWTVKVEATGLKPDTKYFFQFADCANVQTVSPVGMTRTIATAAKHVNGGDP
LTFAVFSCSQYQSGWFNAYGFAARNTSADIFVHLGDYIYEYVQGGASIGRTVLGRELATI
HDYRQRLNQYRTDASLVAAHAKAPWITDDHEVADNTWKAGSANSNDSASGCTWSPSGACF
TDRKFAAIRAYHEWMPIRQVDASDKLRIWRNFKIGKLLDLTMLDTRVYDRDLTDQLNHCD
VVVNSIAAFPNRSIMGLAQEKWLYDTISRSQERGAVWRVIGQQIVFSQLNFGGSFDLVRP
SADAWDGYRANRGRVLDHLYRNKIKNTVILSGDSHANWVSDLAHPNDTVTYNPKTGAGSI
GVEFAGTAVTSPSAFGAWITPAAANNISRQLVAINSDLQWSEASYRGFFTLTIDSETLNA
TYYAMNNISFANLDGFASANFVVSNGENKLSRPVAGGVVKASVLKDV

BLAST