GenomeNet

>lbc:LACBIDRAFT_300718 K02358 elongation factor Tu | (RefSeq) hypothetical protein (A)
MLPLATCKAVSRGLTAARSSLLLACQRSPRSGIPSFALCRGYAEQFSRSKPHMNIGTIGH
VDHGKTTLTAAITKVLSTQGGAKFTDYSQIDKAPEEKARGITINSAHVEYETATRHYGHI
DCPGHADYIKNMITGAAQMDGAIIVVSATDGQMPQTREHLLLARQVGIKRLVVFINKVDQ
ISDPEMLELVDMEMRDLLTTYNFDGESTPIIMGSALAALEGRNDDIGATKIQELVNACDE
WLELPLRDLEKPFLMPIEDVFSISGRGTVATGRVERGIALKGSDVEVVGFGANFKTTLTG
IEMFHKELDRAEAGDNMGALLRGIKREQIRRGHVLAAPGSVKAAKKFLAQIYVLTKDEGG
RYTPFMSNYRPQCFIRTADITVALTFPEGTPDAAEKMVMPGDNVELVCDLYFDVALEEGT
RFTLREAHKTIGTGIVTKILE

BLAST