GenomeNet

>lbc:LACBIDRAFT_300718 hypothetical protein; K02358 elongation factor Tu (A)
MLPLATCKAVSRGLTAARSSLLLACQRSPRSGIPSFALCRGYAEQFSRSKPHMNIGTIGH
VDHGKTTLTAAITKVLSTQGGAKFTDYSQIDKAPEEKARGITINSAHVEYETATRHYGHI
DCPGHADYIKNMITGAAQMDGAIIVVSATDGQMPQTREHLLLARQVGIKRLVVFINKVDQ
ISDPEMLELVDMEMRDLLTTYNFDGESTPIIMGSALAALEGRNDDIGATKIQELVNACDE
WLELPLRDLEKPFLMPIEDVFSISGRGTVATGRVERGIALKGSDVEVVGFGANFKTTLTG
IEMFHKELDRAEAGDNMGALLRGIKREQIRRGHVLAAPGSVKAAKKFLAQIYVLTKDEGG
RYTPFMSNYRPQCFIRTADITVALTFPEGTPDAAEKMVMPGDNVELVCDLYFDVALEEGT
RFTLREAHKTIGTGIVTKILE

BLAST