GenomeNet

>lbc:LACBIDRAFT_315146 hypothetical protein (A)
MSLRYIRDRIVKRVDFIAESRAPLDTDGAHPQSHVFEKTVTEIHELLVKPAFQVSDLGAY
WDAIQNLSTVGLNDRDLLLEKVLVLMSRLQHTKISLKVQQFVINLLYKDLPHPPSGYLGL
SPSSTLCHHHKTLEDASTHALVKYAYRAADGSNYNPLFPTLGKAGSPYARSVPSANIVPS
SALPDPELVFDTLLRRQKFVPHPGGISSLFFAFADLVIHSIFNTNHFDWSINDASSYLDL
SVLYGSSESQVNSVRRRDGTGKLFDDVFADSRLLFMPPASCALLVLLNRNHNYIAEKILN
INENGNLSSPPPEDEKLRLAQDDEIFHRARLVNCGYFMHIILGDYVGAILGLVRDESDWR
LDPLMTMREISHEFVPQGEGNVVSIEFNLLYRWHATLSAQDEKWTEGEFNKLFKGKNPND
VTIEDFKNAAHEFMLPPKDPRVWTFKDLKRDDKGRFNDADLAQILQDATEWRAGAYGARG
TPEVLRVIEIMGMKQARSWGTCSLNEFRKFLGLRPYETFAEWNPDREIHTAAAALYRDID
NLELHVGLQAEQTKKPGPGAGLCPGYTISRSILADAVCLTRGDRFLTVDFNPFNLTSWGY
QDCQYDKKDGSYGGLLTKLLFRTLPEHYQRGSAYAHFPFLDPVFMREENLAKTNPSLVDK
YIWTRPRQDSPTVPFDTLESVKKVLKDPHFVSAYDHRLYNVVKPFLPKKRPSAFTTVSKR
LSIIKKSTPTTAVTPTKENEVPEAIRHLHEGVSQVSSLIHGESTADWVAFFSKATEDLIK
AKAFEPVSKGVKYVDIVKDVINILPIHWISHSIAGLPLKTSANPGGVWYEQDTYHKFAVI
ASYVYLNFDPVNDWHLRESSQRYSAEILDIIHAHIEKLTGIQLSIPDALNHLSIGASNKS
HDFLKKVIDANGKNNTRHELAAQVFSATIPTAPLYSQAIAKVVDFYLAREQAVARQEIVN
LANSKDKDAPSKILAYVREALRLNPTVAGVYRTAAQDVLVGSKRVNATEHAFASIVKANL
DPEVFGPHPSVASYSRPADKAGITTIGDFGLLSPVFFDATAPVILGKILSLKNLKPAPGK
SGTLLSFKENWNGTPSTQYINTEGIVGPFPDSLLVQFTPA

BLAST