GenomeNet

>lby:Lbys_3488 2-oxoglutarate dehydrogenase, e1 subunit; K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] (A)
MDQFSYIANGDVSAIEALYKQYLQDPSSVDKSWQFFFKGYEFNNTWGEGPGKAGVSSDSL
QKEREVVHLIRGYRSRGHLLSQIDPIYSKRKYNANLDLKFFGLSEADYDTVFEAGVEVFG
RPATLRELETFLKNVYGGKIGYEYLYIRDSKVKNWLRNKVESDYLNYKPSKEQKLRILGN
LNKAVAFENFLHTKFLGKKRFSLEGGESTIPALDAAIQHGAKLGVEEVVIGMAHRGRLNV
LTNIMQKPYEQVFNEFEENVPTLEFSDGDVKYHMGYSSQVETVEGHRVSLKLMANPSHLE
TVDPVVLGYARARADAHFKSEGTKYNSFDDIYDKILPIIIHGDASLAGQGVVYEVNQMSN
LPGYYVGGAIHFIINNQIGFTTDNRDARSSIYSSDVAKMLDTPILHVNGDDAEAVVYAME
LAIEFRQEFNKDIYIDMICYRKYGHNEADEPKFTQPGMYEIISKHPSPREIYIEKLKSDG
TITDNDARTLKEQFDNNLQDLLSKVKQNQLPYELPKLERDWAELRRSTVGDFDSSPRTGI
SREEIELVGKALSTVPEGFTPIKQIEKVLEERREIFAGKKPFNWAAAELLAYGSILAEEK
WVRMSGQDVQRGTFSHRHAILHDVKTYEAYNNLAHIKPNQGKFEIYNSLLSEYAVMGFEY
GYALANPNALVIWEAQFGDFANGAQIMIDQFVVAAESKWNLMNGLVLLLPHGYEGQGPEH
SNARPERFLQLAGEYNIYVCNCTTPANFFHMLRRQLALPFRKPCVHMSPKSMLRHPMAIS
DISEFETGTSFREVIGDADADPKKVKRVLLCTGKIYYDLLKRKMDSKREDIAIIRLEQLY
PLPKVQLLAELEKYAGAEQIWVQEEPLNMGYWSYLRREYPEANWDVISRKISASPATGYT
KNHNEFQNKILDKAFE

BLAST