GenomeNet

>lbz:LBRM_24_1690 putative succinate dehydrogenase flavoprotein; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MLRRTFARLALSRAYPVIDHTYDCVVVGAGGSGLRAAMGVAASGYDVACISKLYPSRSHT
IAAQGGINAALANCEEDDWRWHVYDTVKGSDWLGDQDAIQYMCQEAPCVVSELESMGLPF
LRTKDGFIYQRAFGGQSIHYGGKQARRTCAASDRTGHAMLHTLYGQSFQYGVNFYNEYYC
LDLMMEDGCCRGVMAMSIDDGTIHRFKAKYTVLCTGGYGRVYFTTTSAKSCTGDGTAMVV
RAGLPAEDMEFVQFHPTGIYGPGVLITEGARGEGGYLVNSEGERFMERYAPKAKDLASRD
VVSRAITMEILAGRGCGPKKDHVMLQLHHLDPATLHKKLPGISESAHIFAGVDVTKEPIP
IVPTVHYSMGGVPTLWTGEVISPRNGDDNAIVPGLLAAGECACASVHGANRLGANSLLDI
VVFGKSCANTVIFNLTKEGRKQPDLRADSGEVSIADLDRILSNNGDIPIARIRERMKETM
ALYAAVFRTEENMQTGKRIIEECYRDFSHALVHDKSPVWNSNLIEALELRNLLTNAMMTI
SGAVVRKESRGAHARDDYPERDDHSWMKHTLAYLDDAKGEVRLAYRPVHMETLTNEVDSI
PPAKRVY

BLAST