GenomeNet

>lbz:LBRM_27_0960 K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] | (RefSeq) putative 2-oxoglutarate dehydrogenase subunit (A)
MMRRALSGVIAVRASAMRNYTDARTIRQPNPYDQLVNAENQHYVENLMRQYEADSALVDP
SWVPVLEAIRSRNDDAPVVSTFSRPIDAKSLSEKQRHDNMRLSWMIREYERFGHHMAKVN
PLSGYHADNRILGSRTLAPEEFCFSKEDLKLVFNVTLGASYDATFVSGGTSMTLQEIIDQ
LRRFYCGPIGFEFMSSGFFELRNWFRHEVANSLQPLPDEERKLYYKDVIKACGFEKFLQV
KYATKQRFGLDGGEALIPALNAVILTSSNLGVQSAIIGMAHRGRLNVLANVLHKSLRTIL
NEFEGRVAIENVHVSGDVEYHLGKRKHVKLANNKLIELDLLPNPSHLEAVNPLVLGKAHA
RQVYTDDVECTTVLPILIHGDAAFAGQGSCYETMGFCELENFHVGGTLHLVINNQIGFTT
NPKDSRASAYCTDLSKVNNAPVMHVNGDDVDACVKAAKIAARFRHQFHRDIIIDLVCYRR
NGHNETDMPDFTQPQLYEQIRRHPCLVDIYTKTLIEDGTLTAEEAKVEKTEWDSVLRQAY
ERMNSTQNFVKVMPVFDPESENTSADLSYAKIAAARVPRPAPAVETGVEAQTLRAAGVHL
ASIPKEMQKPHPVVERTYAARKKGTEQGDAIEWCQAELMALATLSMQGVPIRLTGEDVER
GTFTQRHAGITDMKTNLKYFPVKTVSPSQALITISNSSLSELGVCGFEMGYNMENTRSIT
MWEAQFGDFANGAQVIFDQFLSCCEEKWNEHSNLILSLPHGYSGAGPEHSSARVERFLQL
SDDSDRVPSDFRHFSNDQALEIRIRRHNWQVTYPSTPANYFHLLRRQGLREFPKPLVNFF
SKARLRAPNLSKLADMAQGSRFKAVIDTARTEDTVARKVAFCSGQIESIVNDAKTAMQKE
TPGVHDDIVLVTVEQLAPFPWEQVADVMEKYAQRNPDTEFVWLQEEPRNMGMWMHMRPRM
NSLMRHLGLKQNRINVVSRSSSASPSTGYGSVHVEEEKKLIQEIIAG

BLAST