GenomeNet

>lci:LCK_01367 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) DUF557 domain-containing protein (A)
MTERKIPTIMGTQHPDNANAPFWDSSQQPFISAYREMNEAFENFSELNVDEYMWDWEGKH
ADAAVIDRLFSTEYDYFKTNQIGRDKFLTFRFPNIWEEKGYNLMQAMTAILSSEDFAHDL
GFAQRPLFETILPMAQRADQLIEMQVLFEKLANFKSVEFTRSDKNTPYIEMIPLFEDFDT
QLHAPEILKEYLQLHEKHFGFRPKYLRVFLAGSDSALTAGFMSSITGNKLAIARLHEFAR
EENIEIYPISGTGSAIFRGGLSPKRIDRYIKEFPGVRTATVQSAFRYDFPIEDVQSAISE
LKAKLPVVEPLQISAEDQTILAEVAEESAAFYAHTLDQLVPDMQPIFKAFPKRRDRRQHV
GVLGYSRSVDGIELPRAINFTGAFYSIGVPPEFIGFGRALENLNADHLSALVRNYPSMKK
DFQELSHYVNLDALEVLKTQSPAWAEVERDIMILKAIFNLEVGPQTREEQQHAEIALQVV
QIKDGAPIAVTALINRMAQLRHFLG

BLAST