GenomeNet

>lcm:102355065 K05619 transglutaminase 1 [EC:2.3.2.13] | (RefSeq) protein-glutamine gamma-glutamyltransferase K-like (A)
MSGSRFEEKKRALDSNVQTLEEVQPIILKRVRRDSGPSAVGENILTVKSINLLKGKEEIN
KKSHHTDEFEYDELIVRRGQSFHIKLELSRPFNPEADKLLLEMHLGPKPQFGKGTLAIVR
LVQELDPKSWSMKIVKVSDRVLTLKVNSSPEAPIGRYQLIVKSLTLNEEFRTKHNPDDDI
YILFNPWCKADTVYMEDEERRKEYVLNDTGKLYRGMQRWIGASDWNFGQFDQGILEACFF
LLDKGKMPHAGRGDPISMVRVVSAMINSADDDGVLVGNWSGDYSDGITPMAWGGSVEILL
GYYSTGGEPVSFGQCWVFSGLTTTVLRCFGIPTRSVTNFDSAHDTDVSLSMDTYYDEDME
EIRDLNSDSVWQPVATYLYVHTNHFLFSKGTYCCGPASLRAIKNGLVFLKYDAPFIFAEV
NCDRIYWQRKADGTFEKFDVVKNAVGHKISTKAVGSDEREDITHLYKYQEGSEEERISVQ
TACQYGTKPNLYRKDDAANDVTADIKAEDKIQIGSDVMLKISLGNRSMDKRTVSLFVQSS
AILYTGVNKGTFKREQEEIVLGPCEVKEMVKMLKFEEYDDHLVEHGSFMFTILGRVKETK
QVFVKQDHACLSSSSLKIMILGQAEVDREVQAKFEFTNSQTRRIRNVQLRIEGPGLQKPK
TIYIGDIRGNQTMSHTEMIIPSKPGARKLIATLDSHQLITEVQGFANVYVKKPDQCV

BLAST