GenomeNet

>lcm:102355330 TGM1; protein-glutamine gamma-glutamyltransferase K; K05619 transglutaminase 1 [EC:2.3.2.13] (A)
MPHSGRGDPISMVRVVSAMVNSQDDRGVLVGNWSGDYTGGSAPTEWVGSVDILLQFHRTG
EPVNYGQCWVFSGVTTTVLRCLGIPGRSVTNFASAHDTDVSLTTDVYLDENLEPLEHMNF
DSVWNFHVWNDCWMARLDLPPGYGGWQAIDATPQETSAGTYCCGPASLQAIKSGLVYLKC
DAPFIFAEVNSDRIYWQRQHNGTFQKVLVQKNAVGHQISTKAVGLDEREDITHLYKYPED
SEEERIAVETACQYGSKPTVYLNSAVMEDVALDIQTQEDIQMGSDVTVRVLVENCSSEHR
SISLFLKAAVVYYTGVYKNSFKQDREEVLLSPAEGKELLVVLSYSQYQEYLVDQAAMMLT
VSGRVVETGQVLAKQHNFRLRTPDLQIMPYGEAIVGGQMKAEIVFLNPLPKILKNVTFRI
EGPGLQKPKKVQVGDVGRHATVTLKETFVPTKPGPRKLIASLHCRELTQVHGVAEVIVLS
Q

BLAST