GenomeNet

>lcs:LCBD_1353 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) kitH; Thymidine kinase (A)
MAQLFFRYGAMNSGKSIEILKVAHNYEEQNKRVILMTSAVDDRAGVGMIASRIGLERTAI
PITHETNLYDIIKATDPKAACVLIDEAQFLQKHHIFEAARVVDELHIPVMAFGLKNDFRN
ELFEGSKYLLLYADKIEEMKTICWFCAKKAIMNLRIHDGQPVYEGKQVLIGGNESYYPVC
RHHYFHPPLKQIDPTD

BLAST