GenomeNet

>lcs:LCBD_1353 kitH; thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLFFRYGAMNSGKSIEILKVAHNYEEQNKRVILMTSAVDDRAGVGMIASRIGLERTAI
PITHETNLYDIIKATDPKAACVLIDEAQFLQKHHIFEAARVVDELHIPVMAFGLKNDFRN
ELFEGSKYLLLYADKIEEMKTICWFCAKKAIMNLRIHDGQPVYEGKQVLIGGNESYYPVC
RHHYFHPPLKQIDPTD

BLAST