GenomeNet

>ldo:LDBPK_270740 2-oxoglutarate dehydrogenase subunit, putative; K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] (A)
MMRRALSGAVAVRASAMRSYTDARTIRKPNPYDQLVNAENQHYVEDLMRQYEADSALVDP
SWVPVLEAIRSGSDDSPVVATFSRPTDAKSLSEKQRHDNMRLSWMIREYERFGHHMANVD
PLSGYHADNRILGSRTLAPEEFGFTKDDLTHVFNVTFGASHEATFVSGGTAMTLQQIIDQ
LRRLYCGPIGFEFMSSGFFELRNWFRQEVMDSLQPLPAEERRLYYNDVVKACGFEKFLQL
KYATKHRFGLDGGEALIPALKAAILTSSDLGVQSAIIGMAHRGRLNVLANVLRKSLRAIL
NEFEGRVAIEDAHLTGDVEYHLGKRKHVKLPNNKSIELDLLPNPSHLEAVNPLVLGKARA
RQIYTNDVECTAVLPILIHGDAAFAGQGSCYETMGFCELENFHVGGTLHLVINNQIGFTT
NPKDSRASAYCTDLSKVNNAPVMHVNGDDVDACVKAAKIAARFRQQFHHDIIIDLVCYRR
YGHNETDLPDFTQPQLYNQIRQHPSVVDIYTKTLIRDGVLTAEEAKAKDKEWEGVLRQAY
DRMNSAQNFVKVMPVFDPESENTSADLSYAKIAATRVPPPVSAVDTGVETQTLRMAGLRL
ASIPKEMQKPHPVVERTYAARKKGTEQGDAIEWCQAELMALATLSMQGVPIRLTGEDVER
GTFTQRHAGITDMKTNLKYFPVKTLSPSQALITISNSSLSELGVCGFEMGYNMENTRSIT
IWEAQFGDFANGAQVIFDQFLSCCEEKWNEHSSLVLSLPHGYSGAGPEHSSARVERFLQL
SDDGDRVPSDFRHFPNDQALEIRIRRHNWQVTYPSTPANYFHLLRRQGLREFAKPLINFF
SKARLRAPNLSKLSDMTQGTSFKAVIDTARAKDTVARKVVFCSGQIESIVNDAKAARQKE
TPGVHDDVVLVTVEQLAPFPWEQVADVMEKYAQRNLNTEFVWLQEEPRNMGMWTHMRPRM
NSLMHHLGLKQKRINVVSRPSAASPSTGYGSVHVAEEKKLIAETLA

BLAST