GenomeNet

>lel:LELG_01369 hypothetical protein; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MAYGESYRSRGYRGDRGAGYYGDSSYRKPHSQRDDHGSSRSRLDDTRRNYSPSSGSGGFP
SDGFNRRYANKGRGSTYEKEDWSYRDKRRWHHSGAGVGASGALANTSGKATPLTNTSDRN
SLDAVYSGTDTKTGVNRTDLEFTKLAHHTDFTNAITILNTDSSTPNNSSSSSSSSSNSKN
YKVLYDPELDTSLSKAERKMKSKKLRFNGEGVPTDQLVDPRIANLSHYLLKPNKKSSKFP
FKQLPQARFIYDSDSLGPAPLTTLVIWDLPISVNMQYLKNYLGTYGLIENIEIINDPNTA
VPLGVATFRFKGTPEKSSDLATKFVERVKIELIKINGIALKIGLNDSEDTLLNQKVNIAR
GKIINQRLKREQEEEKRRLKLQEEQKKQEEIAKKEAEIKKQQEIEEAKRRAAELKYKPNT
TLLSSRHDHKVEEGVFLPNELTKYIKNRPYLLIRDKYVPTKKVSSQEIKRTLKKYDWTRV
LSDKTGYYVVFNSLKECIKCFEQEDCRKLFEFRLVMELAVPEGFEESQRGNDEADNDIIE
EASNVLIKEFESFLVKDIRERIIAPHILKLLDHSHYPALVEELKAKEQQEAKAKIAATSN
ASLKLNALSLLEKQKQNLKPKTKYFKQVEDRFGSRKHGKKGAIIPMQHALNDDDDDDDDH
EDEDDDNDGEGASSDEDEITSGSTTPMVREPLKRVHSSSATSIVDEFEVGEPERKKHKKL
RKEMSTESDDEMESISGKNEEDTEDVKRDKKEEEEEEEAEKKEKSTEEQEPMDAEMDDVD
QMSLDSKYRPTEKRPRTVYPETTIPDTVDLRCLQEFIKDAEDLKFAQSILGDVDVMESDV
PVLKNIEYWAWKQGKNTNESEEIVERDEGFIDDEQEAEEIEEEPEEELPAHLESASGCFK
SEGYKKIPDEDKNHYLPHRKRADKFIKTVQYEEDDDEKATEGSHSNNNSNSNNSNSINNG
SSSTTTNNSNSNTNAAQSSRVNRANNRRFAADITAQIGTESDVLSLNALTKRKKPVTFAR
SSIHNWGLYAMEPIAAKEMIIEYVGERIRQQVAEHREKSYLRTGIGSSYLFRIDENTVID
ATKKGGIARFINHCCSPSCTAKIIKVDGKKRIVIYALRDIEANEELTYDYKFERETNDDE
RIRCLCGAPGCKGFLN

BLAST