GenomeNet

>lel:LELG_03676 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) similar to N-acetylglucosamine kinase (A)
MAQHLTSSFEANHSDGLRSLKKEVNIRINSQQISGLASSEEEEEDLKSLESSTGLSPSPS
SPSPSSSSFRSPSATPMSSNESGEYLETSSVLDLAVASFTESLTDKNLCQQSDLLYHDFK
SSLAEDALAMLPNYNLSPTGEESGLYLVIDLGGSTLRVAVVDISPDLDLNRKERVKVVIE
DKWIISNEYKNIDLNFFKFIASKTMEILLKQSAIDSKELIKTGITWSFPLETTDYNNGNI
LHVSKGYTVDPEVHGQNLKSLLETTFLEEFNVEIDVRSILNDSLAVYSAGLFLNSTMKLA
MVLGTGFNLCCSLNSHEQKMHSAKLIDDKILFNTELSFFGQGLVPHFMTKYDGIIDKRLV
EAEQRFKAFSKVDPETNSVFQPNELTTSGRYLPELCRLVIADLWNQKEIFTTFSEQEMDR
LLNVPYDGFEGEIMCIVDECNDYQEINAKMCKCYNWNKAIPETDIKMLKTITAAVIQRAA
FIVANSIIAFFKLQREFNTDDQLKGHLSVGFVGSVLVYFHNYRDLVLKYVNSSQDAQREG
YTIDLQLVENSSIVGAAIGAAYHS

BLAST