GenomeNet

>lel:LELG_05045 hypothetical protein; K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] (A)
MGSSSDSTSNQKPSNNNTPTRIESTSAKIKRKLSIRKMKNSSSAAIEPPKLDQVLSSPEL
EPQTQQERVPQTSAKTNNTNNKPLASTPQSKKTEAKKSDLGKSQPISNGNSKLKPTPANT
KNKVSSGENNIGYSKDGGTRVKVDRPNNDHNSKLTPNALVRSSASSTITATATATDADAE
RDSITTKVSSAAPSMSTTNGARGSEVNKDFKASEETTLEYTKVEDIEPGIARVHAGFRSG
KTQSIQFRLNQLRNLYFAIKENQPAICHALSQDFHRVPSETINYEIATGLGELLYIMSQL
HKWVKPEKVTDLPLNLSTSPVYIERIPLGVVLVIAAFNYPLFVSISPIVGAIAAGNTVVL
KQSEATPHFSQLFTNILSKALDPEIFFPVNGAVPETTELLKQKVDKIIFTGSATVGKIIA
SKAAETLTPTILELGGKTPAFVLDDVKDKDLPTVARRIAWGRFANSGQTCIAVDYVFVAK
SKHDKFVDALKKIVHEEFYSNINANDKNYTHLINQRAFNRIENIIKTTKGDIITGGDVNP
KSLYVAPTVIDNATWSDSSMQAEIFGPILPILTYDDVETASNEVIANHDTPLALYIFTSG
ATSPRVNPQIKTIATKVRSGGMVINDVLMHIALHNAPFGGVGQSGYGAYHGKFSFLAFSH
ERTTIEQQLWNDWVIKARYPPHTNQKDKLVKTSQLSYGGRVWFARDGNVRKEGPTSFFNA
WTGALGLAELVKDFIGASI

BLAST