GenomeNet

>lfc:LFE_2339 pyruvate synthase, alpha subunit; K00169 pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1] (A)
MSEGAGVEVKPTSAGAGVVKESETSEAAKQKVVTPEYMFFEAPRERAFITGSEAAKEAIR
RANVDVAISYPITPQSETMQQVGALWAEGYVKEYYRGEEEIGVMSAIAGSSRAGARSLTA
TAGPGLMRGMEVVASWPGGRMPIVLLIMCRVINAPLSIQPDNAELAYLINTGNIVFHAEN
QQDFFDYTLKAFIISERPEVTLPVAVAVDGFFVTHARGYVMMPSKDIKLPPRDPYHEAVP
VMDNENPPARLSRDAPIQKSNFISYHVHASWQQEVWAAVERSRKYIDLYMGGLVEIVNPD
ADTIVIASGSAVSQSREAVRQAEEDLGERIGLIKIRSLRPFPTKELRDACKNAKRIIVPE
FNCVGWLYRDVAAALYGYSKAEIIPGPRVFGGISLPTEMILQYIFPDKKFVF

BLAST