GenomeNet

>lfc:LFE_2466 ribulose-bisphosphate carboxylase-like protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MSEMIRATYAIASNDLPRAAALIAREMSVGVKKTRYENSKTGGFMATVDTIKKVGSRGII
TIDVPSANISTVYGLLLSIAGEISCLKILKSIELLDFDLPKALADRLPGPAFGLSGIKKR
RGNLDRPLFITVIKPSQGLTPEEYAHIAYESLVGGMDAIKSDELLQESDKNWTARFEAAV
AAARRAEKETGEPKNVMMHPVDTPMKMVDRFSRGANMGCDLAMLSPAASGFPMLEELARM
ERFPIMAHMAMSGWLWQKNGMSVRAWSKFMRLAGADIVLYPALKGTLKATRSELLEVMDA
VKTPLGTRKESLIAVGGGMHAGTMKVHYDLFGPDFAYLCGGGVCGHPDGARAGGKSIRQA
WDAISQGIPLSRYRKDHPELDAALTAFTRYV

BLAST