GenomeNet

>lfe:LAF_0247 beta-galactosidase large subunit; K01190 beta-galactosidase [EC:3.2.1.23] (A)
MEAELKWLDDPEVFRVNQLPAHSDHRFYRDQEEAALEKSSYVQNLNGRWGFKFSKNPMER
PVDFYKLDFDRNDFGEIEVPSEIELSNFAQINYTNITMPWTGKIYRRPAYTLGDNKEEGS
FSQGQDNTVGSYVRHFTLAEGLKNHDVHVVFEGVERAMYVWLNGHFIGYAEDSFTPSEFD
LTPYLVDGDNLLAVEVYKHATSSWIEDQDMFRFSGIFRDVNLVAQPSIHVQDLKINARVA
DDMKTGSLGLVLKMVGQPGSVQVEVADQTGAAVLNRQLNADGNWTMAPVQLVGIHLWDNH
HPYLYQLTLTVRDATGRVVEVIPYQFGFRRVEIDQDKVLRLNGKRLIINGVNRHEWNCHR
GRAVTIEDMHTDLGIFKENNINAVRTSHYPDQIPWYYLCDREGIYMMAENNLESHATWQK
FGQDEPSYNVPGSLPQWKEAVVDRARSNYEIFKNHTAILFWSVGNESYAGEDILAMNNYY
KEVDDTRPVHYEGVVHTKEYRDQISDFESWMYLPPKEVEAYLKKNPDKPFIECEYMHSMG
NSVGGMGSYIKLLDKYPQYCGGFIWDFVDQAIEVVDPVTGQKSMRYGGDFDDHHADNEFS
GDGICFADRTPKPAMQEVKYYYGLHK

BLAST