GenomeNet

>lfe:LAF_0247 K01190 beta-galactosidase [EC:3.2.1.23] | (GenBank) beta-galactosidase large subunit (A)
MEAELKWLDDPEVFRVNQLPAHSDHRFYRDQEEAALEKSSYVQNLNGRWGFKFSKNPMER
PVDFYKLDFDRNDFGEIEVPSEIELSNFAQINYTNITMPWTGKIYRRPAYTLGDNKEEGS
FSQGQDNTVGSYVRHFTLAEGLKNHDVHVVFEGVERAMYVWLNGHFIGYAEDSFTPSEFD
LTPYLVDGDNLLAVEVYKHATSSWIEDQDMFRFSGIFRDVNLVAQPSIHVQDLKINARVA
DDMKTGSLGLVLKMVGQPGSVQVEVADQTGAAVLNRQLNADGNWTMAPVQLVGIHLWDNH
HPYLYQLTLTVRDATGRVVEVIPYQFGFRRVEIDQDKVLRLNGKRLIINGVNRHEWNCHR
GRAVTIEDMHTDLGIFKENNINAVRTSHYPDQIPWYYLCDREGIYMMAENNLESHATWQK
FGQDEPSYNVPGSLPQWKEAVVDRARSNYEIFKNHTAILFWSVGNESYAGEDILAMNNYY
KEVDDTRPVHYEGVVHTKEYRDQISDFESWMYLPPKEVEAYLKKNPDKPFIECEYMHSMG
NSVGGMGSYIKLLDKYPQYCGGFIWDFVDQAIEVVDPVTGQKSMRYGGDFDDHHADNEFS
GDGICFADRTPKPAMQEVKYYYGLHK

BLAST