GenomeNet

>lga:LGAS_1249 thymidine kinase (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLFFRYGAMSSGKSIEILKVAHNYEAQGRKIALMTSSVDDRSGVGTVASRIGLHRKAE
PISEDLNLFNYVSEMNKNDVESGNGTVACVLIDEAQFLKKHHVLECARIVDELKIPVMAF
GLKNDFQNHLFEGSENLLIFADKIEEMKTICHYCGHKATMNLRINSGKPVYEGEQVQIGG
DESYYPVCRFHYFHPDKQR

BLAST