GenomeNet

>lgv:LCGL_0030 K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] | (GenBank) dihydrolipoamide dehydrogenase E2 subunit (A)
MTEIFKMPDIGEGMHEGDIANWLVKVGDVVKEDDPVAEVQNDKLMQEILSPYSGTVTKLF
VEAGTTVEVGAPLIEYDGDGSSEADTADAAPAAASEAPSGDAQIFTMPDIGEGMHEGDIA
NWLVKVGDDVKEDDPVAEVQNDKLMQEILSPYSGKVTKLFVEAGTTVEVGAPLIEYNGNG
STAAATPAPKAAPTADTAPAAAPKAEGGATTRTTADGRVLAMPSVRHYAREHGIDLTQVQ
STGRHGHTTLADVKAFASGAAAPKAAAPTEAKPAPKADAAKPAAPKPAPAPVQAAEGDRR
EPMTPTRKAISNAMSTQNANIPAVTNFDQVEVSKLVAHRKEYKEIAAKQDVKLTYLAYVT
KALAATAKKFPEINASIDGTDIVYHNDVNIGIAVNAPSGLYVPVIKNADKKSIFTIAKEI
SELAEAVRTGSIKPDQMRGSTITISNIGSARGTWFTPIINGSDVMILGLGSIVKEPIVNA
EGELAVGQNMKLSVSYDHRLIDGMLGQGSLNYLKSLLADPAYMLMEV

BLAST