GenomeNet

>lhe:lhv_0801 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) Thymidine kinase (A)
MSQLFFRYGAMSSGKTIEILKVAHNYEAQGRKIALMTSGLDNRSGVGTVASRIGLHRKAI
PITADMNLYTYIEKMNSHDLADGKGKLACVLIDEAQFLKRHHVLECAKIVDEFNIPVMAF
GLKNDFQNHLFEGSENLLIFADKIEEMKTICHYCGHKATMNLRVNNGKPVYEGEQVQIGG
DESYYPVCRYHYFHPGIQR

BLAST