GenomeNet

>lic:LIC12677 ATP-dependent DNA ligase; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MNHKLIFRDDKSDKFWNIETSGNSFTVTYGKTGTAGTSQTKTFETEETCIKEARKLLSEK
LKKGYIEGNDRTEKLTSNNDKKHKSNQQEADKIVISKSEEKTKSAPQKVIEESENEIKQS
SQTSANKKENLKQNSQTQEQNSNPLPSENSTELNKISLYYQGDGSDKVYHVNIDPEGDGY
VVHFAFGRRGSSLQTGTKTSKPVSYEAAQKIMRQLVNSKMAKGYTEIESGTPYLHSTKEE
RVSGVHCQLLNPIDEEELSTYVEDDQYGAQEKLDGNRMMIRKIGDNVEGINRKGLIIAIS
QILHDHSLSFSEDFILDGEVIGDVFFPFDIFSKDGKDIQHLPYQERYAILESILKDQDEI
FHIVKLVKSTKGKKVLLEELREKQKEGIVFKDLNAPYKAGRPSSKGSQIKFKFYETATVS
VETVNLKRSVSMRLYNGNEWVSVGNVTIPVNFAIPKENDIIEVRYLYAYKGGSLYQPTYL
GARTDADENDCDLKQLKYKNA

BLAST