GenomeNet

>lif:LINJ_19_1480 K04371 mitogen-activated protein kinase 1/3 [EC:2.7.11.24] | (RefSeq) MPK4; putative mitogen activated protein kinase 4 (A)
MAQLVPLVELPSGKKIYSVRGQQFEVDRQYDLVKVVGFGACGTVCSAVANGSGERVAIKR
LSRVFGDLREGKRILREMEIMTSLKHNNLIRLHHFMRPQSKETFEDIYLVMDLYDTDLNR
IIRSRQKLTDEHLQYFMIQAFRGLHYLHSAKVMHRDLKPSNLLVNADCALAICDFGLARD
DQVMSSSDLTQYVVTRWYRPPEVLGMGSNQYTSAVDVWSLGLIFAELMLGRTLLPGTDYI
GQLVMIVNLLGSPSIDDMEFLSSEAKAFILSQPRRPALSFRDLFPMATEEATDLLSKLLV
FHPARRLTAKQVMEHPYFSKYRDAAEEADAPDPFVWNHSHIETKEQLREDLWRVVEAHSQ
SNG

BLAST