GenomeNet

>lif:LINJ_24_1700 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) putative succinate dehydrogenase flavoprotein (A)
MLRRTFTRLALSRAYPVIDHTYDCVVVGAGGSGLRAAMGVAASGYDVACISKLYPSRSHT
IAAQGGINAALANCEEDDWRWHVYDTVKGSDWLGDQDAIQYMCQEAPCVVSELESMGLPF
LRTKDGFIYQRAFGGQSIHYGGKQARRTCAASDRTGHAMLHTLYGQSFQYGVNFYNEYYC
LDLIMEDGCCRGVMAMSIDDGTIHRFKSKYTVLCTGGYGRVYFTTTSAKSCTGDGTAMVA
RAGLPAEDMEFVQFHPTGIYGPGVLITEGARGEGGYLVNSEGERFMERYAPKAKDLASRD
VVSRAITMEILAGRGCGPKKDHVMLQLHHLDPATLHKKLPGISESAHIFAGVDVTKEPIP
IVPTVHYSMGGVPTLWTGEVISPRNGDDNAIVPGLLAAGECACASVHGANRLGANSLLDI
VVFGKSCANTVIFNLTKEGRKQPELRADAGEASIADLDRILNNKGDIPIARIRERMKETM
ALYAAVFRTEESMQTGKKIIEECYRDFSHAFVHDKSPVWNSNLIEALELRNLLTNAMMTI
SGAVVRKESRGAHARDDYQERDDHNWMKHTLAYLDDAKGKVRLAYRPVHMEMLTNEVESI
PPAKRVY

BLAST