GenomeNet

>lil:LA_0984 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (RefSeq) cdc9; ATP-dependent DNA ligase (A)
MNHQLIFRDDKSDKFWNIETSGNFFTVTYGKTGTAGTSQTKTFETEETCIKEARKLLSEK
LKKGYIEGNDRTEKLTSNNDKKHKSNQQEADKIVISKSEEKTKSAPQKVIEESENEIKQS
SQTSANKKENLKQNSQTQEQNSNPLPSENSTELNKISLYYQGDGSDKVYHVNIDPEGDGY
VVHFAFGRRGSSLQTGTKTSKPVSYEAAQKIMRQLVNSKMAKGYTEIESGAPYLHSTKEE
RVSGVHCQLLNPIDEEELSTYVEDDQYGAQEKLDGNRMMIRKIGDNVEGINRKGLIIAIS
QILHDHSLSFSEDFILDGEVIGDVFFPFDIFSKDGKDIQHLPYQERYAILESILKDQDEI
FHIVKLVKSTKGKKVLLEELREKQKEGIVFKDLNAPYKAGRPSSKGSQIKFKFYETATVS
VETVNLKRSVSMRLYNGNEWVSVGNVTIPVNFAIPKENDIIEVRYLYAYKGGSLYQPTYL
GVRTDADGNDCDLKQLKYKNT

BLAST