GenomeNet

>lin:lin0885 hypothetical protein; K01775 alanine racemase [EC:5.1.1.1] (A)
MVTGWHRPTWIEIDRAAIRENIKNEQNKLPDKVALWAVVKANAYGHGIIETAKIAKEAGA
KGFCVAILDEALALREAGFRNEFILVLGATRKEDANLAAKNNISVTVFREDWLDDLTLEA
PLRIHLKVDSGMGRLGIRSREEAQRIETTIAIDHQMILEGIYTHFATADQLETSYFEQQL
AKFQAILSSLTTRPTFVHTANSAASLLQPQIDFDAIRFGISMYGLTPSTEIKNSLPFELK
PALALYTEMVHVKELAPGDSVSYGATYTATEKEWVATLPIGYADGLIRHYSGFHVLVEGE
RAPIIGRICMDQTIIKLPREFQTGTKVTIIGSDHGNKVTADDAAEYLGTINYEVTCLLTE
RIPRKYIN

BLAST