GenomeNet

>lip:LI0332 glgP; carbohydrate phosphorylase family protein; K16153 phosphorylase / glycogen(starch) synthase [EC:2.4.1.1 2.4.1.11] (A)
MQQAVEQTTLFEVSWEVCNKVGGIYTVVTTKVPQAIKTFGDNYYLIGPNLGNNADFQETD
EPCWETLSQSLAIRSLHCRFGRWNIPGNPKVILVNFKDRYNQNQLLYEFWNRYGVDSMTG
GWDYIEPVMFGSACGEVINIAVKTLVEPVGGTAVAHFHEWMCGSGLLTIKQLAPDVGTVF
TTHATILGRSMAGAGIDIYENLSQINPQREAAAYNITAKQSMESITAREADYFTTVSEIT
ADEAEAFLGRRPDIITPNGLDLHIIADFSKDTSLTTTARQSILSRASQFIGQQLPNDTRI
MIISGRYEFHNKGFDVFLDALGNVEQALRNSNKYVLALCTAIGGHTGVTKYALENHLESN
MITPPMPLRIVTHHVYNIEQDPIITKCLRLGLTNHEEDHVKIIFVPALLNGQDGFFNMQY
EQVLPGCDLGVFPSWYEPWGYTPQESAAHAVPTVTTDLSGFGMWVRKLQENNHVTDGISV
IHRLHMPYDDTVNALQSVILEYATCSSEKLMQHRIAVRKVSEECSWEKFFPYYIQSYHSA
LAKANERISIHEPQKQTNTLVITGVSKTPNLRMLTAINQLPQKLGRLREVVNNVWWTWQP
EAETIFTLLSKELWKQSGHNPLKMLEDICPAALMAAEKNTEIQECYNELITKFDEYMKNK
PHTTDPSISSYHPIAYFSTEYGLHESIPLYSGGLGILSGDHLKAASDLNIPMVAIGLLYK
NGYFQQRIDAQGNQIAMYPENNFSLLPISLVKTLQGDPVRIELDLFPGRQLFAQVWKMQV
GHVPLYLLDTDIPQNILDDRRITARLYESDRDCRIRQEILLGMGGVRLLNLLKIMPSIYH
MNEGHSAFMILERIRNLMLWFNLPFNTAQECVRGNTVFTTHTPVDAGNERFDPSLMEKYF
SDYAKSVNLTWNDFMSLGRFSTNDRNMFEMTLLAIRNANKVNGVSRLHSQVSKHMWANNW
KGLPVPEIPIGYVTNGVHIASYVGEHTRKLLKKYVHELWDSLPTSHEAWKNVAQIPDEEL
WKARLEQKQPLLNVIKHLAMSSNLSYKIFAEEQQSIIQQLSEDVLIIGFARRFAPYKRAN
LILANPDRLHHILNNPQKPTILVFAGKAHPADQQGIDLIKQVINYTKDPRFYGKIFFIEN
YNLAIAKILLQGCDVWLNTPRRPYEACGTSGQKVGANGGLNLSIADGWWCEGYNSHNGWT
IGKEIVDILPESEQCDYSDAESLYSLLEESVLPLYFKKDTNSFSPSWIAMVKNAMQTLIP
EFNAERMLHQYLDDYYLPLAKNQVTFRGDNFAIPKQITKWKQGLEQRFATIKIRNVQIEG
LTEDTVLYGEPLTITVTLSPESMKVDELLVQLVIGPGKDNTFTEMPDVLTLMVSQQSGKE
VTFSGVYNIKYNGPNVYGIRILPTMPGLLSPYETGLILWV

BLAST