GenomeNet

>lip:LI0332 K16153 glycogen phosphorylase/synthase [EC:2.4.1.1 2.4.1.11] | (GenBank) glgP; carbohydrate phosphorylase family protein (A)
MQQAVEQTTLFEVSWEVCNKVGGIYTVVTTKVPQAIKTFGDNYYLIGPNLGNNADFQETD
EPCWETLSQSLAIRSLHCRFGRWNIPGNPKVILVNFKDRYNQNQLLYEFWNRYGVDSMTG
GWDYIEPVMFGSACGEVINIAVKTLVEPVGGTAVAHFHEWMCGSGLLTIKQLAPDVGTVF
TTHATILGRSMAGAGIDIYENLSQINPQREAAAYNITAKQSMESITAREADYFTTVSEIT
ADEAEAFLGRRPDIITPNGLDLHIIADFSKDTSLTTTARQSILSRASQFIGQQLPNDTRI
MIISGRYEFHNKGFDVFLDALGNVEQALRNSNKYVLALCTAIGGHTGVTKYALENHLESN
MITPPMPLRIVTHHVYNIEQDPIITKCLRLGLTNHEEDHVKIIFVPALLNGQDGFFNMQY
EQVLPGCDLGVFPSWYEPWGYTPQESAAHAVPTVTTDLSGFGMWVRKLQENNHVTDGISV
IHRLHMPYDDTVNALQSVILEYATCSSEKLMQHRIAVRKVSEECSWEKFFPYYIQSYHSA
LAKANERISIHEPQKQTNTLVITGVSKTPNLRMLTAINQLPQKLGRLREVVNNVWWTWQP
EAETIFTLLSKELWKQSGHNPLKMLEDICPAALMAAEKNTEIQECYNELITKFDEYMKNK
PHTTDPSISSYHPIAYFSTEYGLHESIPLYSGGLGILSGDHLKAASDLNIPMVAIGLLYK
NGYFQQRIDAQGNQIAMYPENNFSLLPISLVKTLQGDPVRIELDLFPGRQLFAQVWKMQV
GHVPLYLLDTDIPQNILDDRRITARLYESDRDCRIRQEILLGMGGVRLLNLLKIMPSIYH
MNEGHSAFMILERIRNLMLWFNLPFNTAQECVRGNTVFTTHTPVDAGNERFDPSLMEKYF
SDYAKSVNLTWNDFMSLGRFSTNDRNMFEMTLLAIRNANKVNGVSRLHSQVSKHMWANNW
KGLPVPEIPIGYVTNGVHIASYVGEHTRKLLKKYVHELWDSLPTSHEAWKNVAQIPDEEL
WKARLEQKQPLLNVIKHLAMSSNLSYKIFAEEQQSIIQQLSEDVLIIGFARRFAPYKRAN
LILANPDRLHHILNNPQKPTILVFAGKAHPADQQGIDLIKQVINYTKDPRFYGKIFFIEN
YNLAIAKILLQGCDVWLNTPRRPYEACGTSGQKVGANGGLNLSIADGWWCEGYNSHNGWT
IGKEIVDILPESEQCDYSDAESLYSLLEESVLPLYFKKDTNSFSPSWIAMVKNAMQTLIP
EFNAERMLHQYLDDYYLPLAKNQVTFRGDNFAIPKQITKWKQGLEQRFATIKIRNVQIEG
LTEDTVLYGEPLTITVTLSPESMKVDELLVQLVIGPGKDNTFTEMPDVLTLMVSQQSGKE
VTFSGVYNIKYNGPNVYGIRILPTMPGLLSPYETGLILWV

BLAST