GenomeNet

>liv:LIV_2454 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) Putative thymidine kinase (A)
MAQLFFRYGSMNSGKTIEILKVAHNYEEQNKSVVIFTSGIDDRDQVGFISSRIGLKREAI
PIFSDTNIYEIVAKITPKPSCVLLDESQFLEKEHVFQLAKIVDDLNIPVIAYGLKNDFRN
ELFEGSKYLLLYADKLEEMKTICWFCAKKATMVLRVDDKGKPVYTGEQIMIGGNDHYYPV
CRKCHAHPPIK

BLAST