GenomeNet

>ljf:FI9785_1279 tdk; hypothetical protein; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLFFRYGAMSSGKSIEILKVAHNYEAQGRKIALMTSNVDDRSGVGTVASRIGLHRKAV
PISEDLNLFNYVSELNKSDVETGNGRVACVLIDEAQFLKRHHVLECAKIVDELKIPVMAF
GLKNDFQNHLFEGSENLLIFADKVEEMKTICHYCGHKATMNLRINSGKPVYEGEQVQIGG
DESYYPVCRFHYFHPNKQR

BLAST