GenomeNet

>ljf:FI9785_1279 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; tdk (A)
MAQLFFRYGAMSSGKSIEILKVAHNYEAQGRKIALMTSNVDDRSGVGTVASRIGLHRKAV
PISEDLNLFNYVSELNKSDVETGNGRVACVLIDEAQFLKRHHVLECAKIVDELKIPVMAF
GLKNDFQNHLFEGSENLLIFADKVEEMKTICHYCGHKATMNLRINSGKPVYEGEQVQIGG
DESYYPVCRFHYFHPNKQR

BLAST