GenomeNet

>ljf:FI9785_926 ppc; hypothetical protein; K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MSIKKLENSSDHAMVAEEVKILTNLLNESTRQLSGDVIFNKIQDLIKISAQKDYDTLEKR
VANLTNQEMIVVARYFATLPLLVNISEDVELASEVNLLNNTDQDYLGKLEDTIDLVAQKE
NANEILKHVNVVPVLTAHPTQVQRKTVLELTDQIHNLLRSYREVKNGTINQAEWTEKLRA
YIEILMQTDIIRSHKLQVSNEITNVLAYYPKALIPAITKFTARYQELAEKHNLDLKGATP
ITMGMWIGGDRDGNPYVTADTLKLSASLQSQVIFEYYIKKLNKLYRTISMSTSYMKTSPA
VERLSELSNDDSPFRTNEPYRRAFYYIESRLLHTEYQLLGTADKNSFVKKRDLENLDKIP
VYNDPQDFKADLVTIKESLEQDHDQAVIISFFTELLEAIDIFGFHLATIDMRQDSSVNEA
CVAELLKSAGICDNYSELPEKDKIKVLLNELNNDPRNLHANNKPKSELLQKELKIYKTAR
QLKDCIGEDVIKQHIISHTESVSDLLEQAIMLKEYDLLDNQGARIQVVPLFETVEDLENS
REIMKEFLNLDIVKKWLASQNDYQEIMLGYSDSNKDGGYLASCWNLYKAQKDLTAMGKKL
GVNITFMHGRGGTVGRGGGPSYEAITAQPFGSINDRIRMTEQGEIIQNKYGNRDTAYYNL
EMLASATIDRIVSKQIVSEDDIGEFRASMDKIVLDSNKVYRKLVFETPAFLDYFLQATPI
KQISNLNIGSRPAARKKITDFSGLRAIPWVFSWSQSRIMFPGWYGVGSAFKHFIDADSHN
LDTLQKMYQGWPFFHSLLSNVDMVLSKSNMDIAKQYADLCEDEDTKKVFDTIYQEWKLTK
EVILQIEGNKELLADNPSLKMSLNYRMPYFNILNYIQVEMIKRDRVDDIAGVYESILPIT
INGVTSGLRNSG

BLAST