GenomeNet

>lki:LKI_07680 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) conserved Archaeal protein (A)
MTQRKIPTIMGTQHPDNANAPFWDASQQPFISAYREMNEAFENFSELNVDEYMWDWEGKH
ADAAVIDRLFSTEYDYFKKDQIGRDKFLTFRFPNIWEEKGYNLMQAMTAILSSEDFAHDL
GFDQRPLFETILPMAQRADQLIEMQVLFEKLANFKSVEFTKNDRNTPYIEMIPLFEDFNT
QLHAPEILKEYLKLHEEHFGFRPKYLRVFLAGSDSALTAGFMSSITGNKLAIARLHEFAQ
EENIDIYPISGTGSAIFRGGLSPRRIDRYLTEFPGVRTATVQSAFRYDFPLEEVQQAIAE
LKEKLPVATPLKISRDDQKILAEVAEESAEFYAHTLDQLVPDMQPIFKAFPKRRDRRQHV
GVLGYSRSVDGIELPRAINFTGSFYSIGVPPEFIGFGRALAHLNADHLSVFVRNYPSMKQ
DFRELAAYVNLDALQILKTQSPAWADVEEDIMTLKNIFDLEIGPKTREQQQHAAIALQVV
QIKEGAPIATTALINRMAQLRHFLG

BLAST