GenomeNet

>lla:L152977 K01834 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11] | (RefSeq) yrgI; hypothetical protein (A)
MTEVYFIRHSLRDNAAYDDMDVPLTAEGEKRALILADAFANVSIEQIFSSPFQRSVRTLN
PLAHSKNLEIQLISDFRERNVGHEIADFWPFAKQQWNDFDYKFADGESLREVQNRNISAL
EQILTTSKNQKVAIGTHGTSLSTILNFYQPDFQFQDFQSLAGKMPYVIKMDFAENKYLTH
QVIEIDYEQ

BLAST