GenomeNet

>llm:llmg_0555 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; Tdk protein (A)
MAQLYFKYGTMNSGKSIEILKVAHNYEEQGKPVLLMTSSLDTRAGVGTVASRIGMKAEAI
AIDDKMSVFDYVNSLSAKPFCVLIDEAQFLNKKHVYDFARVVDELNVPVMAFGLKNDFRN
ELFEGSKYLLLLADKIEEIKTICWYCSKKATMVIRTIDGKPVYEGEQLQIGGNETYIPVC
RKHYFKPEI

BLAST