GenomeNet

>llm:llmg_1704 K01775 alanine racemase [EC:5.1.1.1] | (GenBank) alr; Alr protein (EC:5.1.1.1) (A)
MKTSPHRNTSAIVDLKAIRNNIEKFKKHINPNAEIWPAVKADAYGHGSIEVSKAVSDLVG
GFCVSNLDEAIELRNHLVTKPILVLSGIVPEDVDIAAALNISLTAPSLEWLKLVVQEEAE
LSDLKIHIGVDSGMGRIGIRDVEEANQMIELADKYAINFEGIFTHFATADMADETKFKNQ
QARFNKIMAGLSRQPKFIHSTNTAAALWHKEQVQAIERLGISMYGLNPSGKTLELPFEIE
PALSLVSELTHIKKIAAGETVGYGATYETSEETWIGTVPIGYADGWTRQMQGFKVLVDGK
FCEIVGRVCMDQMMIKLDKSYPLGTKVTLIGRDKANEITTTDVADWRGTINYEVLCLLSD
RIKRIYK

BLAST