GenomeNet

>lln:LLNZ_05170 K01805 xylose isomerase [EC:5.3.1.5] | (GenBank) XylA protein (A)
MAYFNDIAPIKYEGTKTKNMFAFRHYNPEEVVAGKTMEEQLHFALAFWHTITMDGADPFG
SATMERPWDLEGGSELDRAHRRVDAFFEIAEKLGVKYYCFHDIDIAPTGNSLKEFYANLD
EITDHLLEKQKETGIKLLWNTANMFSNPRYMNGVSTSNRAEVFAYGAAQVKKGLELSKKL
DGENYVFWGGREGYESLLNTDMGLEMDHMAKFFHLAIDYAKWFCCKVLNKE

BLAST