GenomeNet

>llt:CVCAS_0503 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) yfiG; thymidine kinase (A)
MAQLYFKYGTMNSGKSIEILKVAHNYEEQGKPVLLMTSSLDTRAGVGTVASRIGMKAEAV
AIDEEMSVFDYVNSLPAKPFCVLIDEAQFLNKKHVYDFARVVDELNVPVMAFGLKNDFRN
ELFEGSKYLLLLADKIEEIKTICWYCSKKATMVIRTIDGKPVYEGEQLQIGGNETYIPVC
RKHYFKPEI

BLAST