GenomeNet

>llt:CVCAS_0503 yfiG; thymidine kinase (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLYFKYGTMNSGKSIEILKVAHNYEEQGKPVLLMTSSLDTRAGVGTVASRIGMKAEAV
AIDEEMSVFDYVNSLPAKPFCVLIDEAQFLNKKHVYDFARVVDELNVPVMAFGLKNDFRN
ELFEGSKYLLLLADKIEEIKTICWYCSKKATMVIRTIDGKPVYEGEQLQIGGNETYIPVC
RKHYFKPEI

BLAST