GenomeNet

>lma:LMJF_21_0550 K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] | (RefSeq) dihydrolipoamide acetyltransferase precursorlike protein (A)
MMRRTLLWLVNFEPVFMPALSPSMETGTVVEWKKKIGELVKESDVFCTIQTDKAVVDYTN
TFESGYLAKIYCGNGQSAPVAKTIAVMVSDAADVSKADEYTPEGEVPAAEAEAPTAAAVA
AAPAAGGASSKAPEGVTCEPVFMPALSPSMETGTVVEWKKKIGELVKESDVFCTIQTDKA
VVDYTNTFESGYLAKIYCGNGQSAPVAKTIAVMVSDAADVEKVANYYPEDAVGGPPASAA
DPSAAAAAAASARPAPSAASAKHYGGSLDAAVAASGPSVARIAAGLETSTLAGIAPSGKG
GRFLKSDFSGQPGFDYNDTTPARAMQQKAAPAAAADEASKTAAKSAAPAAVSGDIYNVVL
KPGPVYKSVSDTALLKKLMHTMHVPKPKLKKAAE

BLAST