GenomeNet

>lma:LMJF_23_0430 K01785 aldose 1-epimerase [EC:5.1.3.3] | (RefSeq) aldose 1-epimerase-like protein (A)
MADTQPVPATVTSAHGAHAEAFGESFIVTLSSENLRVQLLSHGAALNSVQVRKPHPAASA
TASASATAEQDDEWLEVCLGYTNPEEALSADAVIGHTIGRYAGRIANGEFEIANTTYTLA
KNFGPHNLHGGPVGFQHQEWKYLLSDGRDETGVAFHLVSPHMDQGFPGELFVTATYSIIK
SAPVPTLKYVLQASLSDNTPVDMTVINLTNHAYWNLNGVPRPAAADAVAPLPRSIANHYL
QLQSKYFAVTDELSIPNGDMRPVEGTPHDYSALRCVAEGMEATKEEGRDGGGYDDPVALE
TWDSTLREAALVYSPATKLRMQVCTTNPAIVVYTANHLPADASGSKGQRFQQHSAICLEC
QYFPNSPNVRAFPSTVLKKGEAYNETTIHAFQFMNADITPEEKLLRRQ

BLAST