GenomeNet

>lmc:Lm4b_02513 thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLFFRYGSMNSGKTIEILKVAHNYEEQNKTVAIFTSGIDDRDQVGFISSRIGLKREAT
PIFSDTNIFEIVANIKPKPNCVLLDESQFLEKEHVFQLAKIVDELNIPVIAYGLKNDFRN
ELFEGSKYLLLYADKLEEMKTICWFCAKKATMVLRVDDKGKPVYTGEQIMIGGNDHYYPV
CRKCHANPPIK

BLAST