GenomeNet

>lmn:LM5578_0966 K01775 alanine racemase [EC:5.1.1.1] | (GenBank) dal; hypothetical protein (A)
MVTGWHRPTWIEIDRAAIRENIKNEQNKLPESVDLWAVVKANAYGHGIIEVARTAKEAGA
KGFCVAILDEALALREAGFQDDFILVLGATRKEDANLAAKNHISLTVFREDWLENLTLEA
TLRIHLKVDSGMGRLGIRTTEEARRIEATSTNDHQLQLEGIYTHFATADQLETSYFEQQL
AKFQTILTSLKNRPTYVHTANSAASLLQPQIGFDAIRFGISMYGLTPSTEIKTSLPFELK
PALALYTEMVHVKELAPGDSVSYGATYTATEREWVATLPIGYADGLIRHYSGFHVLVDGE
PAPIIGRVCMDQTIIKLPREFQTGSKVTIIGKDHGNTITADDAAQYLDTINYEVTCLLNE
RIPRKYIH

BLAST