GenomeNet

>lmy:LM5923_0920 dal; hypothetical protein; K01775 alanine racemase [EC:5.1.1.1] (A)
MVTGWHRPTWIEIDRAAIRENIKNEQNKLPESVDLWAVVKANAYGHGIIEVARTAKEAGA
KGFCVAILDEALALREAGFQDDFILVLGATRKEDANLAAKNHISLTVFREDWLENLTLEA
TLRIHLKVDSGMGRLGIRTTEEARRIEATSTNDHQLQLEGIYTHFATADQLETSYFEQQL
AKFQTILTSLKNRPTYVHTANSAASLLQPQIGFDAIRFGISMYGLTPSTEIKTSLPFELK
PALALYTEMVHVKELAPGDSVSYGATYTATEREWVATLPIGYADGLIRHYSGFHVLVDGE
PAPIIGRVCMDQTIIKLPREFQTGSKVTIIGKDHGNTITADDAAQYLDTINYEVTCLLNE
RIPRKYIH

BLAST