GenomeNet

>lmy:LM5923_2578 K01580 glutamate decarboxylase [EC:4.1.1.15] | (GenBank) hypothetical protein (A)
MLYSEDDKRKQESYRIPLFGSEEESTSIPKYVLKKEPMEPRIAYQLVKDQLMDEGNARQN
LATFCQTYMEKEAEILMAETLEKNAIDKSEYPQTAELENRCVNILADLWNAPKDMSYLGT
STVGSSEACMLGGLAMKFRWRNNAEKRGLDIQAKRPNLIISSGYQVCWEKFCVYWDVDMR
VVPMDKDHLSLDVDKVFDLVDEYTIGIVGILGITYTGKFDDIQLLDEKVEAYNETNEHQL
VIHIDGASGAMFTPFVNPELPWDFRLKNVVSINTSGHKYGLVYPGVGWILWKDKEYLPKE
LIFEVSYLGGSMPTMAINFSRSASQIIGQYYNFLRYGFEGYREIHEKTKKTALYLAKTVE
KSGYFEIINDGANLPIVCYKMKEGLDVEWTLYDLADQLLMKGWQVPAYPLPADLSDTIIQ
RFVCRADLGYNVAEEFAADFADAIHNLEHARVLYHDKERNDSYGFTH

BLAST