GenomeNet

>loa:LOAG_16100 K00693 glycogen synthase [EC:2.4.1.11] | (RefSeq) hypothetical protein (A)
MATAKNELPPICTHNMVDPSDHVLNALRRTQLINNPSDRVKVIFHPEFLSSVSPLIGLDY
EEFVRGCHIGVFPSYYEPWGYTPAECTVMGVPSVSTNLSGFGCFIQVSM

BLAST