GenomeNet

>lpf:lpl1418 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) hypothetical protein (A)
MKENVSHLPRELSRMVFWSLTCLKKAIAEVYGKETYERIEQIRLSMQDTIGSESFSLGKA
LHNLQIELSKLEKKQLYQIAHGFSLMMELINTCENAYRIFRINQRKEQVYSDMPQGIHYV
LTAHPTEARTNEFLKLFKEIRDYLIEVLKSPYLMNEPHLDQMLKISLQINISYHEKPSVE
DEAQYIYQYALHPLNIKLYHSFLAKGVPIQLRTWVGGDKDGHSGVNEKIMLKSLELSRSF
FIAYIQECLEEVLEIIKLSTALGKNKSLADQINQLVKKAYGLKKIQSKDHEKISAFKNEL
TATQINALKFLNFEPEQFSIISSIFHLYPALVMPIELREDSTIVKESLTSIKKTTITKML
EQVHSITHGTDPKNYIRGFILSMVESAEDIKNGINLVKKVFKGYALPVVPLFENQLALTN
ADTILNNSITEDIRQKHLKQWEGNYEVMLGYSDSSKENGVLPSRLMIAKSLKNIQSTLEN
KNLRPIFFHGSGGSIERGGGDVKEQTASWSKEMMSNYKVTVQGEMVARLFGSSSILKSQV
DKFLDIYSQKGKNTDNGYPEELSSFSARVSQKYKTLIQSDWFWQIIEQASPYHFLKELKI
GSRPTKRKSGPDQRKLRAIPWILCWTQTRLLFPTWWGIGSAWSELNGIEKNRLKALYKEN
ALFAAFVKQLGVTLSKVYLPVWEHYLLQLTGSIEYLKPFQSELESTIQFFYQITDEKDFC
FHQPWLGESIQLRSTLIHPLNLIQIEAMKRKDLPLLRKTVTGISCGMLTTG

BLAST