GenomeNet

>lpf:lpl1634 K01176 alpha-amylase [EC:3.2.1.1] | (GenBank) hypothetical protein (A)
MIDYLPQLQAMGFNAVWINPVQTAGDVQGLFKRDKTIGVRAYNEVTRSLYAMTDCDLISP
YFNPLPPNVDPKLKKQLDMEAMQKFTSEARNNGLVPMFDLVLNHVAADSRHRKEHPEWFQ
KDVHPDFKDAIAFDYSDPQIRDEIIEQFWKPYIYKYMIDYGFEGVRIDAVGYLNPELRKQ
IYAYIYDLAEQFNKPKPVILDELLFSGSQKLTDVVDGLLLPEKGPTHITRGTYYAQRDGY
GGLPGWCKEEEGVKAQVVFLDKQKKLHPHAKGGCIAFSGNHDHNSLAMTILEEMAEHRLA
NHHTLHGAQEKFKHERSYDYDEALESVLRYSFVKDIQNEILSGNESTIKEVETRMREKIA
FCALTSSGGWYALSGDETGDLLAKPVFRRVHALDQTYYAQRTHIIFDKKYPDNKVAMEVL
TEMAIENIQKEKAGSIYNSLQHDKQSQERLLVPYLETLQNQINCGDTVVCKAFQEKLAQR
NITIGFTDENYSPDPRTPQNGWNGQHDMRKFMFEINNILSSLPSSNMGFWSEVIPIQSKP
GLLAVVRKNGLGLSSDTDIAIVNMDPSQKVELTRDDIHQLACNFQKRVISEYTYYNDGKD
KQYNWHTNNPDFNMAYHTVMSCIEAKRIHVDNSIKTNFPVHSANPYGLFSKKQSTKMSIT
KMEKMTEEDTTLIEKGVGDQEVTPVNDQQNQIPIITVDIKH

BLAST