GenomeNet

>lpj:JDM1_2776 K01190 beta-galactosidase [EC:3.2.1.23] | (GenBank) lacM; beta-galactosidase, small subunit (A)
MAYTNNQLHVIYGDGSLGLQGANFQYLFSYERGGLESLVVNDKEWLYRTPTPIFWRATTD
NDHGSGFSVKSAQWYAADKFSTCQDIELTVDDQPVTPLPIAPLNNKYTDHEIATKVSLAY
HFVTTTVPSTIVTVTYTVTADGQINIATHYSGQSDLPELPAFGLRFIMPTTATGFDYTGL
SGETYPDRLAGATHGQFHVDSLPVTPYLVPQECGMHMQTEQVTVTRSTTQNNADHDNTPF
SLTFSQADAPFAFSCLPYTAAELENATHMEELPLARRTVLSIYGAVRGVGGIDSWGTDVE
SPYHIPADQDIDFSFNIHF

BLAST