GenomeNet

>lpp:lpp0690 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; hypothetical protein (A)
MAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQTLLFTPAIDTRFQYGTICSRIGLSEQAY
AFNNSDNLYVLTQEFQLQTQKYSCVLIDEAQFLTREQVYQLTEITDQMSIPVLAYGLRTD
FRGELFPGSQFLLAWADELIELKTICHCGRKAIMNMRIDENGQAVIEGEQVLIGGNESYV
ATCRLHYKRGEAGKTFPRNKLFNKDTNTF

BLAST