GenomeNet

>lpp:lpp1643 hypothetical protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MGYHFLAEGNGIIACYDMYPTQFHSIKDMINYLPVLKQMGFNALWINPMQMPGDISGFFK
TDKNNGVKTGNEVTRSLYAMSHPLLFNPQFSLDSPEDPMETTQRLNSEALQLFTQNARNL
GIVPMFDLVLNHVAIDSPLCQDKPHWFKGVHEDFKDVRGFNYDDESIRKEIITEFWQPYI
KRYMIEYGFDGVRVDAVGYVHPAVRSEVYAYIHSLAAEYGKPNPVILDEALFSKRPLADE
VNYLKLPGIGPTHITTEAYNVEFDLASADLPYEITLEEQLKASVVFQQKDGTWRENTKGG
CINFCGNHDYRSLAMTILFQMAKKRLKSDAFYNDLISSYQDLYFKFNAEQEKPHELKEPL
KTTLLYSYVDQIKKELEDNKDETAQEFKTLVLEKLALSALTASGGWFLLSGDETCDITAK
TVFQRKGAVDKSYYPQREHRIFSEKPVIAHKILEKMAEENFFIENSENKWMQELYRSLSS
FPEMQKRLLVSHIDNIKHQINAGIDHVQEKFSRLLASESLNIGFTSQDFLENPRTHENGW
LGLQDNFLFIKQLNRLLKTLPAPLPGFSSELVRLPEKPHLIIIVRKNGNELNAPIDVVVV
NLEQEKRQTLTKEDFQLIAKNYCNQYFSKNRPSVCDSLREKLYSHVLKSAVNNRVHTDTS
IKLNGIHLFEFKETSLNTFFTIEKEKNYSHGNEDHTALTGNTILH

BLAST