GenomeNet

>lra:LRHK_1161 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase family protein (A)
MAQLFFRYGAMNSGKSIEILKVAHNYEEQNKRVILMTSAVDDRAGVGMIASRIGLERTAI
PIAHETNLYDVIKTTDPKAACVLIDEAQFLQKHHIFEAARVVDELHIPVMAFGLKNDFRN
ELFEGSKYLLLYADKIEEMKTICWFCAKKAIMNLRIHDGKPVYEGEQVLIGGNESYYPVC
RHHYFHPPLDKIDQDEE

BLAST