GenomeNet

>lre:Lreu_0451 thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAQLFFKYGAMNSGKSIDILKVAHNYEEQGKPVVLMTSGVDDRSGRGIIASRIGLERKVK
PIMDDTNIYDYVNKMDRKIYCVLIDEAQFLKKEHVLQLIKIVDELNIPVMAFGLKNDFRN
ELFEGSKYLLIYADKIEEMKTICWFCPHKATMNLRIHNGKPVYEGEQVQIGGNESYYPVC
RKHYFHPQLKQ

BLAST